Recombinant Full Length Human CD226 Protein, C-Flag-tagged
Cat.No. : | CD226-1273HFL |
Product Overview : | Recombinant Full Length Human CD226 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and megakaryocytic cells to vascular endothelial cells. The protein also plays a role in megakaryocytic cell maturation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.5 kDa |
AA Sequence : | MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR RERRDLFTESWDTQKAPNNYRSPISTGQPTNQSMDDTREDIYVNYPTFSRRPKTRVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs) |
Full Length : | Full L. |
Gene Name | CD226 CD226 molecule [ Homo sapiens (human) ] |
Official Symbol | CD226 |
Synonyms | PTA1; DNAM1; DNAM-1; TLiSA1 |
Gene ID | 10666 |
mRNA Refseq | NM_006566.4 |
Protein Refseq | NP_006557.2 |
MIM | 605397 |
UniProt ID | Q15762 |
◆ Recombinant Proteins | ||
CD226-5128Z | Recombinant Zebrafish CD226 | +Inquiry |
Cd226-8794R | Active Recombinant Rat Cd226 protein, hFc-tagged | +Inquiry |
CD226-2190H | Recombinant Human CD226, His tagged | +Inquiry |
Cd226-2274MAF555 | Recombinant Mouse Cd226 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD226-578H | Recombinant Human CD226 protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD226-1167CCL | Recombinant Cynomolgus CD226 cell lysate | +Inquiry |
CD226-2645HCL | Recombinant Human CD226 cell lysate | +Inquiry |
CD226-1173RCL | Recombinant Rat CD226 cell lysate | +Inquiry |
CD226-2800MCL | Recombinant Mouse CD226 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD226 Products
Required fields are marked with *
My Review for All CD226 Products
Required fields are marked with *
0
Inquiry Basket