Recombinant Full Length Human Cd151 Antigen(Cd151) Protein, His-Tagged
Cat.No. : | RFL3136HF |
Product Overview : | Recombinant Full Length Human CD151 antigen(CD151) Protein (P48509) (1-253aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-253) |
Form : | Lyophilized powder |
AA Sequence : | MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNT ELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVV PDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD151 |
Synonyms | CD151; TSPAN24; CD151 antigen; GP27; Membrane glycoprotein SFA-1; Platelet-endothelial tetraspan antigen 3; PETA-3; Tetraspanin-24; Tspan-24; CD antigen CD151 |
UniProt ID | P48509 |
◆ Recombinant Proteins | ||
RFL11726MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Cd151 Antigen(Cd151) Protein, His-Tagged | +Inquiry |
CD151-2786H | Recombinant Human CD151 protein, His-tagged | +Inquiry |
CD151-2945HF | Recombinant Full Length Human CD151 Protein | +Inquiry |
CD151-1434M | Recombinant Mouse CD151 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD151-0905H | Recombinant Human CD151 Protein (Met1-Ser167), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD151 Products
Required fields are marked with *
My Review for All CD151 Products
Required fields are marked with *
0
Inquiry Basket