Recombinant Full Length Human CCR7 Protein, C-Flag-tagged
Cat.No. : | CCR7-875HFL |
Product Overview : | Recombinant Full Length Human CCR7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICF VGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSF FSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRC SLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYN GVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQE QLRQWSSCRHIRRSSMSVEAETTTTFSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, GPCR, Transmembrane |
Protein Pathways : | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Full Length : | Full L. |
Gene Name | CCR7 C-C motif chemokine receptor 7 [ Homo sapiens (human) ] |
Official Symbol | CCR7 |
Synonyms | BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7 |
Gene ID | 1236 |
mRNA Refseq | NM_001838.4 |
Protein Refseq | NP_001829.1 |
MIM | 600242 |
UniProt ID | P32248 |
◆ Recombinant Proteins | ||
CCR7-854H | Active Recombinant Human CCR7 Full Length Transmembrane protein, His-tagged(Nanodisc) | +Inquiry |
CCR7-3021HF | Recombinant Full Length Human CCR7 Protein | +Inquiry |
CCR7-1077HFL | Recombinant Human CCR7 protein, His&Flag-tagged | +Inquiry |
CCR7-1177H | Recombinant Human CCR7 protein, His&Myc-tagged | +Inquiry |
CCR7-856H | Active Recombinant Human CCR7 Full Length Transmembrane protein(VLP) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCR7 Products
Required fields are marked with *
My Review for All CCR7 Products
Required fields are marked with *
0
Inquiry Basket