Recombinant Full Length Human CCR7 Protein

• Cat.No.: CCR7-3021HF
• Product Overview: Human CCR7 full-length ORF (NP_001829.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 742 amino acids
• Description: The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Sep 2014]
• Form: Liquid
• Molecular Mass: 42.9 kDa
• AA Sequence: MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: CCR7 chemokine (C-C motif) receptor 7 [ Homo sapiens ]
• Official Symbol: CCR7
• Synonyms: CCR7; chemokine (C-C motif) receptor 7; CMKBR7, EBI1; C-C chemokine receptor type 7; BLR2; CD197; CDw197; CCR-7; CC-CKR-7; C-C CKR-7; MIP-3 beta receptor; CC chemokine receptor 7; chemokine (C-C) receptor 7; Epstein-Barr virus induced gene 1; EBV-induced G protein-coupled receptor 1; EBV-induced G-protein coupled receptor 1; Epstein-Barr virus induced G-protein coupled receptor; lymphocyte-specific G protein-coupled peptide receptor; epstein-Barr virus-induced G-protein coupled receptor 1; EBI1; CMKBR7
• Gene ID: 1236
• mRNA Refseq: NM_001838
• Protein Refseq: NP_001829
• MIM: 600242
• UniProt ID: P32248