Recombinant Full Length Human CCNA2 Protein, C-Flag-tagged
Cat.No. : | CCNA2-362HFL |
Product Overview : | Recombinant Full Length Human CCNA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP LVPLDYPMDGSFESPHTMDMSIVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG VSLLNPPETLNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Cell cycle, Progesterone-mediated oocyte maturation |
Full Length : | Full L. |
Gene Name | CCNA2 cyclin A2 [ Homo sapiens (human) ] |
Official Symbol | CCNA2 |
Synonyms | CCN1; CCNA |
Gene ID | 890 |
mRNA Refseq | NM_001237.5 |
Protein Refseq | NP_001228.2 |
MIM | 123835 |
UniProt ID | P20248 |
◆ Recombinant Proteins | ||
CCNA2-4115H | Recombinant Human CCNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCNA2-362HFL | Recombinant Full Length Human CCNA2 Protein, C-Flag-tagged | +Inquiry |
CCNA2-0648H | Recombinant Human CCNA2 Protein, GST-Tagged | +Inquiry |
CCNA2-696R | Recombinant Rhesus monkey CCNA2 Protein, His-tagged | +Inquiry |
CCNA2-31453TH | Recombinant Human CCNA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNA2-7718HCL | Recombinant Human CCNA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCNA2 Products
Required fields are marked with *
My Review for All CCNA2 Products
Required fields are marked with *
0
Inquiry Basket