Recombinant Full Length Human CCL19 Protein, GST-tagged
Cat.No. : | CCL19-2936HF |
Product Overview : | Human CCL19 full-length ORF (AAH27968, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 98 amino acids |
Description : | This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ] |
Official Symbol | CCL19 |
Synonyms | CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433; |
Gene ID | 6363 |
mRNA Refseq | NM_006274 |
Protein Refseq | NP_006265 |
MIM | 602227 |
UniProt ID | Q99731 |
◆ Recombinant Proteins | ||
CCL19-4399M | Recombinant Monkey CCL19 Protein | +Inquiry |
CCL19-151H | Recombinant Human CCL19 Protein, His-tagged | +Inquiry |
CCL19-2891H | Recombinant Human CCL19 Protein | +Inquiry |
Ccl19-6379R | Recombinant Rat Ccl19 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCL19-154H | Recombinant Human Chemokine (C-C motif) Ligand 19, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL19 Products
Required fields are marked with *
My Review for All CCL19 Products
Required fields are marked with *
0
Inquiry Basket