Recombinant Full Length Human CCL19 Protein, GST-tagged

• Cat.No.: CCL19-2936HF
• Product Overview: Human CCL19 full-length ORF (AAH27968, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 98 amino acids
• Description: This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014]
• Molecular Mass: 36.52 kDa
• AA Sequence: MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCL19 chemokine (C-C motif) ligand 19 [ Homo sapiens ]
• Official Symbol: CCL19
• Synonyms: CCL19; chemokine (C-C motif) ligand 19; SCYA19, small inducible cytokine subfamily A (Cys Cys), member 19; C-C motif chemokine 19; beta chemokine exodus 3; CC chemokine ligand 19; CK beta 11; CKb11; EBI1 ligand chemokine; ELC; exodus 3; macrophage inflammatory protein 3 beta; MIP 3b; exodus-3; CK beta-11; MIP-3-beta; EBI1-ligand chemokine; beta chemokine exodus-3; beta-chemokine exodus-3; small-inducible cytokine A19; macrophage inflammatory protein 3-beta; epstein-Barr virus-induced molecule 1 ligand chemokine; small inducible cytokine subfamily A (Cys-Cys), member 19; MIP3B; MIP-3b; SCYA19; MGC34433
• Gene ID: 6363
• mRNA Refseq: NM_006274
• Protein Refseq: NP_006265
• MIM: 602227
• UniProt ID: Q99731