Active Recombinant Mouse Ccl19 Protein (83 aa)

• Cat.No.: Ccl19-022C
• Product Overview: Recombinant Mouse Ccl19 Protein without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 83
• Description: Macrophage Inflammatory Protein-3 beta also called CCL19, ELC (EBI1 Ligand Chemokine), Exodus-3 is a reported β chemokine that binds specifically to the chemokine receptor CCR7/EBI1/BLR2. It is expressed in the thymus, lymph nodes and in activated bone marrow stromal cells. MIP-3 beta is a chemoattractant for T and B lymphocytes and myeloid progenitor cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Measured by its ability to chemoattract human CCR7 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 3-15 ng/mL.
• Molecular Mass: Approximately 9.2 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids.
• AA Sequence: GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS
• Endotoxin: Less than 1 EU/μg of rMuMIP-3b/CCL19 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ]
• Official Symbol: Ccl19
• Synonyms: CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3
• Gene ID: 24047
• mRNA Refseq: NM_011888
• Protein Refseq: NP_036018
• UniProt ID: O70460