Active Recombinant Mouse Ccl19 Protein (83 aa)
Cat.No. : | Ccl19-022C |
Product Overview : | Recombinant Mouse Ccl19 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 83 |
Description : | Macrophage Inflammatory Protein-3 beta also called CCL19, ELC (EBI1 Ligand Chemokine), Exodus-3 is a reported β chemokine that binds specifically to the chemokine receptor CCR7/EBI1/BLR2. It is expressed in the thymus, lymph nodes and in activated bone marrow stromal cells. MIP-3 beta is a chemoattractant for T and B lymphocytes and myeloid progenitor cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to chemoattract human CCR7 transfected BaF3 mouse proB cells. The ED50 for this effect is typically 3-15 ng/mL. |
Molecular Mass : | Approximately 9.2 kDa, a single non-glycosylated polypeptide chain containing 83 amino acids. |
AA Sequence : | GANDAEDCCLSVTQRPIPGNIVKAFRYLLNEDGCRVPAVVFTTLRGYQLCAPPDQPWVDRIIRRLKKSSAKNKGNSTRRSPVS |
Endotoxin : | Less than 1 EU/μg of rMuMIP-3b/CCL19 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl19 chemokine (C-C motif) ligand 19 [ Mus musculus ] |
Official Symbol | Ccl19 |
Synonyms | CCL19; chemokine (C-C motif) ligand 19; C-C motif chemokine 19; chemokine CCL19; EBI1 ligand chemokine; EBI1-ligand chemokine; EBI-1 ligand chemokine; small inducible cytokine A19; small-inducible cytokine A19; EBV-induced molecule 1 ligand chemokine; epstein-Barr virus-induced molecule 1 ligand chemokine; ELC; CKb11; MIP3B; Scya19; exodus-3; |
Gene ID | 24047 |
mRNA Refseq | NM_011888 |
Protein Refseq | NP_036018 |
UniProt ID | O70460 |
◆ Recombinant Proteins | ||
CCL19-151H | Recombinant Human CCL19 Protein, His-tagged | +Inquiry |
CCL19-154H | Recombinant Human Chemokine (C-C motif) Ligand 19, T7-tagged | +Inquiry |
CCL19-4360R | Recombinant Rabbit CCL19 Protein | +Inquiry |
Ccl19-623M | Recombinant Mouse Ccl19 protein | +Inquiry |
CCL19-4365C | Recombinant Canine CCL19 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL19-7729HCL | Recombinant Human CCL19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl19 Products
Required fields are marked with *
My Review for All Ccl19 Products
Required fields are marked with *
0
Inquiry Basket