Recombinant Full Length Human CCL1 Protein, GST-tagged

Description :	This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8. [provided by RefSeq, Sep 2014]
Source :	In Vitro Cell Free System
Species :	Human
Tag :	GST
Molecular Mass :	37.4 kDa
Protein length :	96 amino acids
AA Sequence :	MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ]
Official Symbol	CCL1
Synonyms	CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1;
Gene ID	6346
mRNA Refseq	NM_002981
Protein Refseq	NP_002972
MIM	182281
UniProt ID	P22362