Recombinant Human CCL1 protein(24-96aa), MBP&His-Avi-tagged, Biotinylated

• Cat.No.: CCL1-1168H
• Product Overview: Biotinylated Recombinant Human CCL1 protein(P22362)(24-96aa), fused with N-terminal MBP tag and C-terminal His and Avi tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&His&MBP
• Protein Length: 24-96aa
• Conjugation/Label: Biotin
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 56.3 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Gene Information

• Gene Name: CCL1 chemokine (C-C motif) ligand 1 [ Homo sapiens ]
• Official Symbol: CCL1
• Synonyms: CCL1; chemokine (C-C motif) ligand 1; SCYA1, small inducible cytokine A1 (I 309, homologous to mouse Tca 3); C-C motif chemokine 1; I 309; inflammatory cytokine I 309; P500; SISe; T lymphocyte secreted protein I 309; TCA3; inflammatory cytokine I-309; small-inducible cytokine A1; T lymphocyte-secreted protein I-309; small inducible cytokine A1 (I-309, homologous to mouse Tca-3); I-309; SCYA1
• Gene ID: 6346
• mRNA Refseq: NM_002981
• Protein Refseq: NP_002972
• MIM: 182281
• UniProt ID: P22362