Recombinant Full Length Human CCDC12 Protein, GST-tagged

• Cat.No.: CCDC12-2830HF
• Product Overview: Human CCDC12 full-length ORF (NP_653317.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 166 amino acids
• Description: CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway.
• Molecular Mass: 45.6 kDa
• AA Sequence: MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CCDC12 coiled-coil domain containing 12 [ Homo sapiens ]
• Official Symbol: CCDC12
• Synonyms: CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801
• Gene ID: 151903
• mRNA Refseq: NM_144716
• Protein Refseq: NP_653317
• UniProt ID: Q8WUD4