Recombinant Full Length Human CCDC12 Protein, GST-tagged
Cat.No. : | CCDC12-2830HF |
Product Overview : | Human CCDC12 full-length ORF (NP_653317.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 166 amino acids |
Description : | CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway. |
Molecular Mass : | 45.6 kDa |
AA Sequence : | MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCDC12 coiled-coil domain containing 12 [ Homo sapiens ] |
Official Symbol | CCDC12 |
Synonyms | CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801; |
Gene ID | 151903 |
mRNA Refseq | NM_144716 |
Protein Refseq | NP_653317 |
UniProt ID | Q8WUD4 |
◆ Recombinant Proteins | ||
CCDC12-2824M | Recombinant Mouse CCDC12 Protein | +Inquiry |
CCDC12-10786H | Recombinant Human CCDC12, GST-tagged | +Inquiry |
CCDC12-2363H | Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Ccdc12-1987M | Recombinant Mouse Ccdc12 Protein, Myc/DDK-tagged | +Inquiry |
CCDC12-2830HF | Recombinant Full Length Human CCDC12 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC12-7785HCL | Recombinant Human CCDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC12 Products
Required fields are marked with *
My Review for All CCDC12 Products
Required fields are marked with *
0
Inquiry Basket