Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CCDC12-2363H
Product Overview : CCDC12 MS Standard C13 and N15-labeled recombinant protein (NP_653317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Diseases associated with CCDC12 include Gray Platelet Syndrome. Among its related pathways are mRNA Splicing - Major Pathway.
Molecular Mass : 19.2 kDa
AA Sequence : MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CCDC12 coiled-coil domain containing 12 [ Homo sapiens (human) ]
Official Symbol CCDC12
Synonyms CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801;
Gene ID 151903
mRNA Refseq NM_144716
Protein Refseq NP_653317
UniProt ID Q8WUD4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCDC12 Products

Required fields are marked with *

My Review for All CCDC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon