Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CCDC12-2363H |
Product Overview : | CCDC12 MS Standard C13 and N15-labeled recombinant protein (NP_653317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | CCDC12 (Coiled-Coil Domain Containing 12) is a Protein Coding gene. Diseases associated with CCDC12 include Gray Platelet Syndrome. Among its related pathways are mRNA Splicing - Major Pathway. |
Molecular Mass : | 19.2 kDa |
AA Sequence : | MEATTAGVGRLEEEALRRKERLKALREKTGRKDKEDGEPKTKHLREEEEEGEKHRELRLRNYVPEDEDLKKRRVPQAKPVAVEEKVKEQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAELIRERLKGQEDSLASAVDAATEQKTCDSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CCDC12 coiled-coil domain containing 12 [ Homo sapiens (human) ] |
Official Symbol | CCDC12 |
Synonyms | CCDC12; coiled-coil domain containing 12; coiled-coil domain-containing protein 12; MGC23918; FLJ39430; FLJ40801; |
Gene ID | 151903 |
mRNA Refseq | NM_144716 |
Protein Refseq | NP_653317 |
UniProt ID | Q8WUD4 |
◆ Recombinant Proteins | ||
CCDC12-1497C | Recombinant Chicken CCDC12 | +Inquiry |
CCDC12-1297M | Recombinant Mouse CCDC12 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC12-2363H | Recombinant Human CCDC12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCDC12-2824M | Recombinant Mouse CCDC12 Protein | +Inquiry |
CCDC12-10786H | Recombinant Human CCDC12, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC12-7785HCL | Recombinant Human CCDC12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC12 Products
Required fields are marked with *
My Review for All CCDC12 Products
Required fields are marked with *
0
Inquiry Basket