Recombinant Full Length Human CCBL1 Protein, GST-tagged

Cat.No. : CCBL1-2800HF
Product Overview : Human CCBL1 full-length ORF (AAH33685, 1 a.a. - 374 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 374 amino acids
Description : This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Molecular Mass : 66.88 kDa
AA Sequence : MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELWP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCBL1 cysteine conjugate-beta lyase, cytoplasmic [ Homo sapiens ]
Official Symbol CCBL1
Synonyms CCBL1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); kynurenine--oxoglutarate transaminase 1; glutamine transaminase K; GTK; KATI; kyneurenine aminotransferase; beta-lysase, kidney; kynurenine aminotransferase I; cysteine-S-conjugate beta-lyase; glutamine--phenylpyruvate transaminase; kynurenine--oxoglutarate transaminase I; glutamine-phenylpyruvate aminotransferase; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); KAT1; FLJ95217; MGC29624;
Gene ID 883
mRNA Refseq NM_001122671
Protein Refseq NP_001116143
MIM 600547
UniProt ID Q16773

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CCBL1 Products

Required fields are marked with *

My Review for All CCBL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon