Recombinant Full Length Human CATSPERZ Protein, GST-tagged

• Cat.No.: CATSPERZ-1799HF
• Product Overview: Human C11orf20 full-length ORF ( CAL37866.1, 1 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Predicted to be involved in flagellated sperm motility; male meiotic nuclear division; and sperm capacitation. Located in cytoplasm and sperm principal piece.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.4 kDa
• Protein length: 200 amino acids
• AA Sequence: MEEKPSKVSLKSSDRQGSDEESVHSDTRDLWTTTTLSQAQLNMPLSEVCEGFDEEGRNISKTRGWHSPGRGSLDEGYKASHKPEELDEHALVELELHRGSSMEINLGEKDTASQIEAEKSSSMSSLNIAKHMPHRAYWAEQQSRLPLPLMELMENEALEILTKALRSYQLGIGRDHFLTKELQRYIEGLKKRRSKRLYVN
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CATSPERZ catsper channel auxiliary subunit zeta [ Homo sapiens (human) ]
• Official Symbol: CATSPERZ
• Synonyms: TEX40; C11orf20
• Gene ID: 25858
• mRNA Refseq: NM_001039496.1
• Protein Refseq: NP_001034585.1
• MIM: 617511
• UniProt ID: Q9NTU4