Recombinant Full Length Human CAST Protein, GST-tagged
Cat.No. : | CAST-2751HF |
Product Overview : | Human CAST full-length ORF (NP_775083.1, 1 a.a. - 686 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 686 amino acids |
Description : | The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 100.5 kDa |
AA Sequence : | MNPTETKAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEHTEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAISGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGPEVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFTCGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKPKPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPPEPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPDYRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAISEVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAKAEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDSCPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAST calpastatin [ Homo sapiens ] |
Official Symbol | CAST |
Synonyms | CAST; calpastatin; calpain inhibitor; sperm BS-17 component; BS-17; MGC9402; |
Gene ID | 831 |
mRNA Refseq | NM_001042440 |
Protein Refseq | NP_001035905 |
MIM | 114090 |
UniProt ID | P20810 |
◆ Recombinant Proteins | ||
CAST-0441H | Recombinant Human CAST Protein, GST-Tagged | +Inquiry |
CAST-1363H | Recombinant Human CAST Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CAST-27210TH | Recombinant Human CAST | +Inquiry |
CAST-2638H | Recombinant Human CAST protein, His-tagged | +Inquiry |
CAST-50HF | Recombinant Full Length Human CAST Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAST-7824HCL | Recombinant Human CAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAST Products
Required fields are marked with *
My Review for All CAST Products
Required fields are marked with *
0
Inquiry Basket