Recombinant Full Length Human CALML3 Protein, GST-tagged

• Cat.No.: CALML3-3065HF
• Product Overview: Human CALML3 full-length ORF (AAH31889, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CALML3 (Calmodulin Like 3) is a Protein Coding gene. Among its related pathways are Vascular smooth muscle contraction and Tuberculosis. GO annotations related to this gene include calcium ion binding. An important paralog of this gene is CALM1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.13 kDa
• Protein length: 149 amino acids
• AA Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CALML3 calmodulin-like 3 [ Homo sapiens ]
• Official Symbol: CALML3
• Synonyms: CALML3; calmodulin-like 3; calmodulin-like protein 3; CLP; caM-like protein; calmodulin-related protein NB-1
• Gene ID: 810
• mRNA Refseq: NM_005185
• Protein Refseq: NP_005176
• MIM: 114184
• UniProt ID: P27482