Recombinant Full Length Human BORCS5 Protein, GST-tagged

• Cat.No.: BORCS5-5944HF
• Product Overview: Human LOH12CR1 full-length ORF ( NP_477517.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BORCS5 (BLOC-1 Related Complex Subunit 5) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.6 kDa
• Protein length: 196 amino acids
• AA Sequence: MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BORCS5 BLOC-1 related complex subunit 5 [ Homo sapiens (human) ]
• Official Symbol: BORCS5
• Synonyms: BORCS5; BLOC-1 related complex subunit 5; LOH12CR1; LOH1CR12; BLOC-1-related complex subunit 5; loss of heterozygosity 12 chromosomal region 1 protein; loss of heterozygosity, 12, chromosomal region 1; myristoylated lysosomal protein; myrlysin
• Gene ID: 118426
• mRNA Refseq: NM_001300742
• Protein Refseq: NP_001287671
• MIM: 616598
• UniProt ID: Q969J3