Recombinant Full Length Human B9D2 Protein, GST-tagged

• Cat.No.: B9D2-1749HF
• Product Overview: Human B9D2 full-length ORF ( NP_085055.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a B9 domain protein, which are exclusively found in ciliated organisms. The gene is upregulated during mucociliary differentiation, and the encoded protein localizes to basal bodies and cilia. Disrupting expression of this gene results in ciliogenesis defects.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 45.7 kDa
• Protein length: 175 amino acids
• AA Sequence: MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: B9D2 B9 protein domain 2 [ Homo sapiens ]
• Official Symbol: B9D2
• Synonyms: B9D2; B9 protein domain 2; B9 domain-containing protein 2; MGC4093; MKS1-related protein 2; involved in cIlia stability-1; MKS10; MKSR2; ICIS-1
• Gene ID: 80776
• mRNA Refseq: NM_030578
• Protein Refseq: NP_085055
• MIM: 611951
• UniProt ID: Q9BPU9