Recombinant Full Length Human ATG4B Protein, C-Flag-tagged
Cat.No. : | ATG4B-1974HFL |
Product Overview : | Recombinant Full Length Human ATG4B Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.1 kDa |
AA Sequence : | MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDT GWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIG QWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGA EVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPH TTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFE LVEQQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Protein Pathways : | Regulation of autophagy |
Full Length : | Full L. |
Gene Name | ATG4B autophagy related 4B cysteine peptidase [ Homo sapiens (human) ] |
Official Symbol | ATG4B |
Synonyms | APG4B; AUTL1; HsAPG4B |
Gene ID | 23192 |
mRNA Refseq | NM_013325.5 |
Protein Refseq | NP_037457.3 |
MIM | 611338 |
UniProt ID | Q9Y4P1 |
◆ Recombinant Proteins | ||
ATG4B-826M | Recombinant Mouse ATG4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG4B-9975H | Recombinant Human ATG4B, GST-tagged | +Inquiry |
ATG4B-5507Z | Recombinant Zebrafish ATG4B | +Inquiry |
ATG4B-5909H | Recombinant Human ATG4B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATG4B-1974HFL | Recombinant Full Length Human ATG4B Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG4B-8624HCL | Recombinant Human ATG4B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG4B Products
Required fields are marked with *
My Review for All ATG4B Products
Required fields are marked with *
0
Inquiry Basket