Recombinant Full Length Human APOA1 Protein, C-Flag-tagged
Cat.No. : | APOA1-979HFL |
Product Overview : | Recombinant Full Length Human APOA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.9 kDa |
AA Sequence : | MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKL LDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYR QKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | PPAR signaling pathway |
Full Length : | Full L. |
Gene Name | APOA1 apolipoprotein A1 [ Homo sapiens (human) ] |
Official Symbol | APOA1 |
Synonyms | HPALP2; apo(a) |
Gene ID | 335 |
mRNA Refseq | NM_000039.3 |
Protein Refseq | NP_000030.1 |
MIM | 107680 |
UniProt ID | P02647 |
◆ Recombinant Proteins | ||
APOA1-303C | Recombinant Cynomolgus APOA1 Protein, His-tagged | +Inquiry |
APOA1-33H | Recombinant Human APOA1 protein(Met1-Gln267), hFc-tagged | +Inquiry |
APOA1-698H | Recombinant Human APOA1 protein | +Inquiry |
APOA1-357H | Recombinant Human APOA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA1-217H | Recombinant Human APOA1, C13&N15-labeled | +Inquiry |
◆ Native Proteins | ||
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
APOA1-8344H | Native Human APOA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOA1 Products
Required fields are marked with *
My Review for All APOA1 Products
Required fields are marked with *
0
Inquiry Basket