Recombinant Full Length Human Amphiregulin(Areg) Protein, His-Tagged
Cat.No. : | RFL-33712HF |
Product Overview : | Recombinant Full Length Human Amphiregulin(AREG) Protein (P15514) (101-184aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (101-184) |
Form : | Lyophilized powder |
AA Sequence : | SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | AREG |
Synonyms | AREG; AREGB; SDGF; Amphiregulin; AR; Colorectum cell-derived growth factor; CRDGF |
UniProt ID | P15514 |
◆ Recombinant Proteins | ||
AREG-746R | Recombinant Rat AREG Protein | +Inquiry |
Areg-517R | Recombinant Rat Areg protein, His & T7-tagged | +Inquiry |
Areg-5643M | Recombinant Mouse Areg protein, hFc-tagged | +Inquiry |
AREG-02H | Active Recombinant Human AREG Protein | +Inquiry |
RFL-9669RF | Recombinant Full Length Rat Amphiregulin(Areg) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AREG Products
Required fields are marked with *
My Review for All AREG Products
Required fields are marked with *
0
Inquiry Basket