Recombinant Full Length Rat Amphiregulin(Areg) Protein, His-Tagged
Cat.No. : | RFL-9669RF |
Product Overview : | Recombinant Full Length Rat Amphiregulin(Areg) Protein (P24338) (97-243aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (97-243) |
Form : | Lyophilized powder |
AA Sequence : | VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Areg |
Synonyms | Areg; Sdgf; Amphiregulin; AR; Schwannoma-derived growth factor; SDGF |
UniProt ID | P24338 |
◆ Recombinant Proteins | ||
Areg-3433R | Recombinant Rat Areg, His-tagged | +Inquiry |
AREG-529H | Recombinant Human AREG protein | +Inquiry |
AREG-746R | Recombinant Rat AREG Protein | +Inquiry |
AREG-743H | Recombinant Human AREG protein, GST-tagged | +Inquiry |
AREG-0293H | Recombinant Human AREG Protein (Ser101-Lys187), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AREG-8762HCL | Recombinant Human AREG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Areg Products
Required fields are marked with *
My Review for All Areg Products
Required fields are marked with *
0
Inquiry Basket