Recombinant Full Length Human ALDOC Protein, C-Flag-tagged
Cat.No. : | ALDOC-831HFL |
Product Overview : | Recombinant Full Length Human ALDOC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG GAAAQSLYIANHAYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Full Length : | Full L. |
Gene Name | ALDOC aldolase, fructose-bisphosphate C [ Homo sapiens (human) ] |
Official Symbol | ALDOC |
Synonyms | ALDC |
Gene ID | 230 |
mRNA Refseq | NM_005165.3 |
Protein Refseq | NP_005156.1 |
MIM | 103870 |
UniProt ID | P09972 |
◆ Recombinant Proteins | ||
ALDOC-26498TH | Recombinant Human ALDOC, His-tagged | +Inquiry |
ALDOC-831HFL | Recombinant Full Length Human ALDOC Protein, C-Flag-tagged | +Inquiry |
Aldoc-1519M | Recombinant Mouse Aldoc protein, His-tagged | +Inquiry |
ALDOC-4510C | Recombinant Chicken ALDOC | +Inquiry |
ALDOC-0192H | Recombinant Human ALDOC Protein (Asp34-Ser281), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDOC-8910HCL | Recombinant Human ALDOC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDOC Products
Required fields are marked with *
My Review for All ALDOC Products
Required fields are marked with *
0
Inquiry Basket