Recombinant Full Length Human ADGRF1 Protein

• Cat.No.: ADGRF1-5566HF
• Product Overview: Human GPR110 full-length ORF (NP_079324.2) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 375 amino acids
• Description: ADGRF1 (Adhesion G Protein-Coupled Receptor F1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity and transmembrane signaling receptor activity. An important paralog of this gene is ADGRF5.
• Form: Liquid
• Molecular Mass: 24.9 kDa
• AA Sequence: MKVGVLWLISFFTFTDGHGGFLGKNDGIKTKKELIVNKKKHLGPVEEYQLLLQVTYRDSKEKRDLRNFLKLLKPPLLWSHGLIRIIRAKATTDCNSLNGVLQCTCEDSYTWFPPSCLDPQNCYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYANGIEIQLKKAYERIQGFESVQVTQFRMSLLSPKLECNGTI
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: ADGRF1 adhesion G protein-coupled receptor F1 [ Homo sapiens (human) ]
• Official Symbol: ADGRF1
• Synonyms: GPR110; G protein-coupled receptor 110; probable G-protein coupled receptor 110; hGPCR36; PGR19; G-protein coupled receptor 110; G protein-coupled receptor PGR19; G-protein coupled receptor PGR19; G-protein coupled receptor KPG_012; seven transmembrane helix receptor; KPG_012; FLJ22684; FLJ30646; MGC125952
• Gene ID: 266977
• mRNA Refseq: NM_025048
• Protein Refseq: NP_079324
• MIM: 617430
• UniProt ID: Q5T601