Active Recombinant Human CLDN6 Full Length Transmembrane protein, His-tagged(VLPs)

Cat.No. : CLDN6-1446H
Product Overview : Recombinant Human CLDN6 Protein(P56747)(1-220aa), fused with C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-220aa
Form : Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Bio-activity : Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody, the EC50 is 1.501-2.035 ng/Ml
Molecular Mass : 25.1 kDa
AA Sequence : MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
Endotoxin : Less than 1.0 EU/ug as determined by LAL method.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CLDN6 claudin 6 [ Homo sapiens ]
Official Symbol CLDN6
Synonyms CLDN6; claudin 6; claudin-6; skullin;
Gene ID 9074
mRNA Refseq NM_021195
Protein Refseq NP_067018
UniProt ID P56747

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CLDN6 Products

Required fields are marked with *

My Review for All CLDN6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon