Recombinant Full Length Human Adenosine Receptor A2B(Adora2B) Protein, His-Tagged
Cat.No. : | RFL-32929HF |
Product Overview : | Recombinant Full Length Human Adenosine receptor A2b(ADORA2B) Protein (P29275) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADORA2B |
Synonyms | ADORA2B; Adenosine receptor A2b |
UniProt ID | P29275 |
◆ Recombinant Proteins | ||
ADORA2B-300H | Recombinant Human ADORA2B protein, His-SUMO-tagged | +Inquiry |
RFL-14450RF | Recombinant Full Length Rat Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
ADORA2B-190R | Recombinant Rat ADORA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9201CF | Recombinant Full Length Dog Adenosine Receptor A2B(Adora2B) Protein, His-Tagged | +Inquiry |
ADORA2B-357M | Recombinant Mouse ADORA2B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA2B-9005HCL | Recombinant Human ADORA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADORA2B Products
Required fields are marked with *
My Review for All ADORA2B Products
Required fields are marked with *
0
Inquiry Basket