Recombinant Full Length Human ADAMTS8 Protein, C-Flag-tagged
Cat.No. : | ADAMTS8-605HFL |
Product Overview : | Recombinant Full Length Human ADAMTS8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms. Reduced expression of this gene has been observed in multiple human cancers and this gene has been proposed as a potential tumor suppressor. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 96.3 kDa |
AA Sequence : | MLPAPAAPRWPPLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAFGKGFVLRLAPD DSFLAPDFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCRGLSGSFLLDGEEFTIQPQGAG GSLAQPHRLQRWGPAGARPLPRGPEWEVETGEGQRQERGDHQEDSEEESQEEEAEGASEPPPPLGATSRT KRFVSEARFVETLLVADASMAAFYGADLQNHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPE VSDNGGLTLRNFCNWQRRFNQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIE DEGLQAAHTLAHELGHVLSMPHDDSKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGGH GDCLLDAPAAALPLPTGLPGRMALYQLDQQCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNG SLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVVDGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNG GRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNYTDMDGNLLQWVPKYAGVSPRDRCKLFCRARG RSEFKVFEAKVIDGTLCGPETLAICVRGQCVKAGCDHVVDSPRKLDKCGVCGGKGNSCRKVSGSLTPTNY GYNDIVTIPAGATNIDVKQRSHPGVQNDGNYLALKTADGQYLLNGNLAISAIEQDILVKGTILKYSGSIA TLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDW SECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Full Length : | Full L. |
Gene Name | ADAMTS8 ADAM metallopeptidase with thrombospondin type 1 motif 8 [ Homo sapiens (human) ] |
Official Symbol | ADAMTS8 |
Synonyms | METH2; ADAM-TS8 |
Gene ID | 11095 |
mRNA Refseq | NM_007037.6 |
Protein Refseq | NP_008968.4 |
MIM | 605175 |
UniProt ID | Q9UP79 |
◆ Recombinant Proteins | ||
ADAMTS8-0160H | Recombinant Human ADAMTS8 Protein (Leu832-Leu889), N-His-tagged | +Inquiry |
ADAMTS8-1511H | Recombinant Human ADAMTS8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ADAMTS8-3009H | Recombinant Human ADAMTS8, His-tagged | +Inquiry |
Adamts8-3016M | Recombinant Mouse Adamts8, His-tagged | +Inquiry |
ADAMTS8-281H | Recombinant Human ADAMTS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAMTS8-9027HCL | Recombinant Human ADAMTS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAMTS8 Products
Required fields are marked with *
My Review for All ADAMTS8 Products
Required fields are marked with *
0
Inquiry Basket