Recombinant Full Length Human ACSS1 Protein, C-Flag-tagged
Cat.No. : | ACSS1-1737HFL |
Product Overview : | Recombinant Full Length Human ACSS1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.1 kDa |
AA Sequence : | MAARTLGRGVGRLLGSLRGLSGQPARPPCGVSAPRRAASGPSGSAPAVAAAAAQPGSYPALSAQAAREPA AFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKSPESVALIWERDEPGTEVR ITYRELLETTCRLANTLKRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRIND AKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAP ESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGP LCNGATSVLFESTPVYPNAGRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPI NCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIAPRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVMEG SNVSGALCISQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRL GTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVKDSAGDSDVVVQELKSMVATKIAKYAVPDEIL VVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSVYQKCKDKQAAAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | ACSS1 acyl-CoA synthetase short chain family member 1 [ Homo sapiens (human) ] |
Official Symbol | ACSS1 |
Synonyms | ACAS2L; ACECS1; AceCS2L |
Gene ID | 84532 |
mRNA Refseq | NM_032501.4 |
Protein Refseq | NP_115890.2 |
MIM | 614355 |
UniProt ID | Q9NUB1 |
◆ Recombinant Proteins | ||
ACSS1-5135Z | Recombinant Zebrafish ACSS1 | +Inquiry |
ACSS1-65H | Recombinant Human ACSS1 Protein, His-tagged | +Inquiry |
ACSS1-812HF | Recombinant Full Length Human ACSS1 Protein, GST-tagged | +Inquiry |
ACSS1-1737HFL | Recombinant Full Length Human ACSS1 Protein, C-Flag-tagged | +Inquiry |
ACSS1-2163H | Recombinant Human ACSS1 Protein (38-689 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSS1-19HCL | Recombinant Human ACSS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSS1 Products
Required fields are marked with *
My Review for All ACSS1 Products
Required fields are marked with *
0
Inquiry Basket