Recombinant Full Length Hordeum Vulgare Mlo Protein Homolog 1(Mlo-H1) Protein, His-Tagged
Cat.No. : | RFL32236HF |
Product Overview : | Recombinant Full Length Hordeum vulgare MLO protein homolog 1(MLO-H1) Protein (O49873) (1-544aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hordeum vulgare (Barley) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-544) |
Form : | Lyophilized powder |
AA Sequence : | MAGPAGGRELSDTPTWAVAVVCAVMILVSVAMEHALHKLGHWFHKWRKKALGEALEKMKA ELMLVGFISLLLIVTQDPVSRICISKEAGEKMLPCKPYDGAGGGKGKDNHRRLLWLQGES ETHRRFLAAPAGVDVCAKQGKVALMSAGSMHQLHIFIFVLAVFHVLYSVVTMTLSRLKMK QWKKWESETASLEYQFANDPSRCRFTHQTTLVRRHLGLSSTPGVRWVVAFFRQFFTSVTK VDYLTLRQGFINAHLSQGNRFDFHKYIKRSLEDDFKVVVRISLKLWFVAVLILFLDFDGI GTLLWMSVVPLVILLWVGTKLEMVIMEMAQEIHDRESVVKGAPAVEPSNKYFWFNRPDWV LFLMHLTLFQNAFQMAHFVWTVATPGLKKCYHEKMAMSIAKVVLGVAAQILCSYITFPLY ALVTQMGSHMKRSIFDEQTAKALTNWRKMAKEKKKARDAAMLMAQMGGGATPSVGSSPVH LLHKAGARSDDPQSVPASPRAEKEGGGVQHPARKVPPCDGWRSASSPALDAHIPGADFGF STQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MLO-H1 |
Synonyms | MLO-H1; MLO protein homolog 1 |
UniProt ID | O49873 |
◆ Recombinant Proteins | ||
FZD8-597H | Active Recombinant Human Frizzled Family Receptor 8, Fc-tagged | +Inquiry |
AKAP3-1477M | Recombinant Mouse AKAP3 Protein | +Inquiry |
Catip-1971M | Recombinant Mouse Catip Protein, Myc/DDK-tagged | +Inquiry |
ANGPT2-28P | Recombinant Pig ANGPT2 Protein, His tagged | +Inquiry |
WDR12-49H | Recombinant Human WDR12, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-60H | Native Human Collagen Type II | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
Heartworm-021C | Native Canine Heartworm Antigen | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
Lectin-1833R | Active Native Ricinus Communis Agglutinin I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IgG3-1606MCL | Recombinant Mouse IgG3 cell lysate | +Inquiry |
HDGFRP3-5597HCL | Recombinant Human HDGFRP3 293 Cell Lysate | +Inquiry |
Brain-082RCL | Post natal Rat brain Whole Cell Lysate | +Inquiry |
MB-4445HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
TBCB-1219HCL | Recombinant Human TBCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MLO-H1 Products
Required fields are marked with *
My Review for All MLO-H1 Products
Required fields are marked with *
0
Inquiry Basket