Recombinant Full Length Rickettsia Bellii Protein Translocase Subunit Secd(Secd) Protein, His-Tagged
Cat.No. : | RFL19801RF |
Product Overview : | Recombinant Full Length Rickettsia bellii Protein translocase subunit SecD(secD) Protein (Q1RIN3) (1-514aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia bellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-514) |
Form : | Lyophilized powder |
AA Sequence : | MQNLPKWKIFLSIICTIFAVICALPNFTQVKSKYLPHDSVNLGLDLRGGAHLLLDVDFDT YLNDTMENLADTLRKSFREDKIGYKNLLVKQNNIQLELRSQEELKPLKRIISKIDPEINV EANDNRIKLSYSESRLSELLNKVVDQSIEIVRMRVDSTGTKEPILQKQGDRHILLQVPGE EDPTYLKNILGKTAKLIFHLVDENANVEEAVKGHVPMGSMLVQGDRMGYLVVKKKAILGG DSLTTAAASFDQNSQAVVSFSFNSLGSKLFGEVTKNNVGKHLAIVLDNKLLSAPTINQPI MGGSGIISGDFTVESANELALLLRAGSLPAPLKIIEERSIGPNLGADSIESGKKAGIIGF AAVCIFMVWSYGLLGLFANIALSLAMLYVLALLSLFQATLTLPGIAGIILTMGMAVDANV LIYERIKEELNKGTSNLYAIKTGFESAFATILDSNLTTLIVAFLLYIFGVGAIKGFAVAL TIGIISSMFSAIIITKLLIDIWVKYFKPKKLGLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | secD |
Synonyms | secD; RBE_0700; Protein translocase subunit SecD |
UniProt ID | Q1RIN3 |
◆ Recombinant Proteins | ||
RFL31679ZF | Recombinant Full Length Zea Mays Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
TAAR64-5395Z | Recombinant Zebrafish TAAR64 | +Inquiry |
Igfbp1-5643M | Active Recombinant Mouse Insulin-Like Growth Factor Binding Protein 1 | +Inquiry |
PBLD1-3949R | Recombinant Rat PBLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NOX4-2200R | Recombinant Rat NOX4 Protein (210-424 aa), His-B2M-tagged | +Inquiry |
◆ Native Proteins | ||
CTSG-8070H | Native Human Neutrophil Cathepsin G Biotinylated | +Inquiry |
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
CP-1767H | Native Human CP Protein | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Skin-144R | Rat Skin Tissue Lysate | +Inquiry |
ZACN-226HCL | Recombinant Human ZACN 293 Cell Lysate | +Inquiry |
STC2-849HCL | Recombinant Human STC2 cell lysate | +Inquiry |
KLHDC7B-4918HCL | Recombinant Human KLHDC7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All secD Products
Required fields are marked with *
My Review for All secD Products
Required fields are marked with *
0
Inquiry Basket