Recombinant Full Length Helicobacter Felis Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL2292HF |
Product Overview : | Recombinant Full Length Helicobacter felis ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (O32617) (1-638aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter felis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-638) |
Form : | Lyophilized powder |
AA Sequence : | MDNNHKGPNDPNSKKPLLQNPLLLIAIFGIIIFVAMRVMNSDEGFGDRFLSTSTKNISYH EMKELIEKKEVDSVSIGQTLIKAISKEGNNKTIYVAKRVPDLSLVPLLDSQKINYSGFSE SNFFADILGWLLPVLVILGLWMFMASRMQKNMGGGIFGMGSSKKLINAEKPKVRFNDMAG NEEAKEEVVEIVDFLKYPDRYASLGAKIPKGVLLVGPPGTGKTLLAKAVAGEASVPFFSM GGSSFIEMFVGLGASRVRDLFDIAKKEAPSIIFIDEIDAIGKSRAAGGMISGNDEREQTL NQLLAEMDGFGSENAPVIVLAATNRPEILDPALLRPGRFDRQVLVDKPDFKGRVEILKVH IKPVKLANDVDLQEIAKLTAGLAGADLANIINEAALLAGRNNQKEVKQQHLKEAVERGIA GLEKKSRRISPKEKKIVAYHESGHAVISEMTKGSARVNKVSIIPRGMAALGYTLNTPEEN KYLMQKHELIAEIDVLLGGRAAEDVFLQEISTGASNDLERATDIIKGMVSYYGMSDVSGL MVLEKQRNSFLGGGFGSGREFSEKMAEEMDSFIKNLLEERYVHVKQTLSDYKDAIEVMVN ELFEKEVITGERVREIISEYEVSHNLQTRLVPLEEHAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Hfelis_12570; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | O32617 |
◆ Recombinant Proteins | ||
RFL17726MF | Recombinant Full Length Mouse Phosphatidylinositide Phosphatase Sac1(Sacm1L) Protein, His-Tagged | +Inquiry |
PPIL1-1753H | Recombinant Human Peptidylprolyl Isomerase (cyclophilin)-Like 1 | +Inquiry |
OPN5-6400M | Recombinant Mouse OPN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP2C2-865R | Recombinant Rat ATP2C2 Protein | +Inquiry |
IL21R-145H | Active Recombinant Human IL21R, MIgG2a Fc-tagged | +Inquiry |
◆ Native Proteins | ||
WIM-5415B | Native Bovine Vimentin | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA3-5134HCL | Recombinant Human ITGA3 293 Cell Lysate | +Inquiry |
ATP5C1-8604HCL | Recombinant Human ATP5C1 293 Cell Lysate | +Inquiry |
ABHD12B-9139HCL | Recombinant Human ABHD12B 293 Cell Lysate | +Inquiry |
RHOH-2349HCL | Recombinant Human RHOH 293 Cell Lysate | +Inquiry |
DPCD-6839HCL | Recombinant Human DPCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket