Recombinant Full Length Halobacterium Salinarum Halobacterial Transducer Protein 5(Htr7) Protein, His-Tagged
Cat.No. : | RFL28332HF |
Product Overview : | Recombinant Full Length Halobacterium salinarum Halobacterial transducer protein 5(htr7) Protein (Q48318) (1-545aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-545) |
Form : | Lyophilized powder |
AA Sequence : | MSGAAVFVDAVVAPLGDAVGAIGFGAAAALGYRNYRDTDAEAAFWMAFTFASLLGVTWTV SLMLEKAGVATQIFNLATGPLMATTVAVFAIGGTATLAIVEDMEALVEERAQRRQEAEEE RAEAERAREKAEQKQAEAERQTAEAESAKQDARERSAEIEQLAADLESQATEVGATLEAA SDGDLTARVDATTDNAEIAEVATVVNDMLTTMERTIDEIQGFSTNVTTASREATAGAKEI QDASQTVSESVQEIAAGTDDQREQLESVAEEMDSYSATVEEVAATAQSVADTAADTTDVA TAGKQTAEDAIDAIDAVQETMQTTVANVDALEDLTTEIDDIAELISDIAEQTNMLALNAN IEAARAGSGGGSNGDGFAVVADEVKELATESQRSAKDIAELIEEVQSQTATTVEEIRVAE QRVNDGAAAVEETVDAFGAVTENIQETTDGVQEISQAMDEQAQRSERVVSSVDDIATISQ ATADRAENVSAASEEQTASITEVTSSLQSLAAQADTLEDRLNEFRTEATGTAHGEATDAP AGQSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Halobacterium salinarum Halobacterial transducer protein 5(htr7) |
UniProt ID | Q48318 |
◆ Recombinant Proteins | ||
SRRT-16007M | Recombinant Mouse SRRT Protein | +Inquiry |
RFL21037SF | Recombinant Full Length Staphylococcus Aureus Cardiolipin Synthase 2(Cls2) Protein, His-Tagged | +Inquiry |
RFL20486MF | Recombinant Full Length Mouse 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 1(Srd5A1) Protein, His-Tagged | +Inquiry |
RPLT-0534B | Recombinant Bacillus subtilis RPLT protein, His-tagged | +Inquiry |
FLJ56323-5276H | Recombinant Human FLJ56323 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
Plg-297M | Active Native Mouse Plasmin | +Inquiry |
ACPP-5290H | Native Human Acid Phosphatase, Prostate | +Inquiry |
Lectin-1778G | Active Native Galanthus Nivalis Lectin Protein, Fluorescein labeled | +Inquiry |
IgM-208M | Native Monkey Immunoglobulin M | +Inquiry |
◆ Cell & Tissue Lysates | ||
CETN2-7561HCL | Recombinant Human CETN2 293 Cell Lysate | +Inquiry |
ONECUT1-3576HCL | Recombinant Human ONECUT1 293 Cell Lysate | +Inquiry |
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
FAAH2-6480HCL | Recombinant Human FAAH2 293 Cell Lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Halobacterium salinarum Halobacterial transducer protein 5(htr7) Products
Required fields are marked with *
My Review for All Halobacterium salinarum Halobacterial transducer protein 5(htr7) Products
Required fields are marked with *
0
Inquiry Basket