Recombinant Full Length Staphylococcus Aureus Cardiolipin Synthase 2(Cls2) Protein, His-Tagged
Cat.No. : | RFL21037SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Cardiolipin synthase 2(cls2) Protein (Q6GEY7) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMERRSANSIWAWLLVLVFLPLFGF ILYLLLGRQIQRDQIFKIDKEDKKGLELIVDEQLAALKNENFSNSNYQIVKFKEMIQMLL YNNAAFLTTDNDLKVYTDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKK AEQGVEVKILYDDMGSRGLRKKGLHPFRNKGGHAEAFFPSKLPLINLRMNNRNHRKIVVI DGQIGYVGGFNVGDEYLGKSKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQATRDHISY DDRYFPDVNSGGTIGVQIASSGPDEEWEQIKYGYLKMISSAKKSIYIQSPYFIPDQAFLD SIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLDAGVKVFHYDNGFLHSKTLVIDD EIASVGTANMDHRSFTLNFEVNAFIYDQQIAKKLKQAFIDDLAVSSELTKARYAKRSLWI KFKEGISQLLSPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls2 |
Synonyms | cls2; SAR2177; Cardiolipin synthase 2; CL synthase 2 |
UniProt ID | Q6GEY7 |
◆ Recombinant Proteins | ||
AZIN1-1869C | Recombinant Chicken AZIN1 | +Inquiry |
VTCN1-531H | Active Recombinant Human VTCN1, MIgG2a Fc-tagged | +Inquiry |
CCND1-3824HFL | Recombinant Full Length Human CCND1 protein, Flag-tagged | +Inquiry |
OTUD1-6434M | Recombinant Mouse OTUD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL13192SF | Recombinant Full Length Saccharomyces Cerevisiae Sterol O-Acyltransferase 2(Are2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TF-71R | Native Rat Apotransferrin | +Inquiry |
Lectin-1866W | Active Native Succinylated Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
MuV-03 | Native Mumps/Parotitis Virus Antigen | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPN-1658HCL | Recombinant Human SNRPN cell lysate | +Inquiry |
CCDC8-7747HCL | Recombinant Human CCDC8 293 Cell Lysate | +Inquiry |
IL13RA2-2758MCL | Recombinant Mouse IL13RA2 cell lysate | +Inquiry |
FCGR2B-001HCL | Recombinant Human FCGR2B cell lysate | +Inquiry |
CXorf48-429HCL | Recombinant Human CXorf48 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls2 Products
Required fields are marked with *
My Review for All cls2 Products
Required fields are marked with *
0
Inquiry Basket