Recombinant Full Length Haemophilus Somnus Upf0283 Membrane Protein Hs_0596(Hs_0596) Protein, His-Tagged
Cat.No. : | RFL28084HF |
Product Overview : | Recombinant Full Length Haemophilus somnus UPF0283 membrane protein HS_0596(HS_0596) Protein (Q0I337) (1-357aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus somnus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-357) |
Form : | Lyophilized powder |
AA Sequence : | MPKKVFQQEDVEQKITENFEPKQEFEQDELDIEMDCSQFETTMDRQNTDIPFQHMVRPKV TMWQKLLMATICLFSCGILAQSVQWLVDSWRDNQWIAFVFAMVSLFLVLLGLGAIIKEWR RLVQLKKRLILQEKSREIRSKSAVNLTEVSSEGKELCLKIASLMGIDDKSPQLIAWQEQV HEAYTEQEILRLFSQNVLIPFDRVAKKLISKNAVESALIVAVSPLAIVDMFFIAWRNIRL INQLAKLYGIELGYVSRLRLLRMVFVNMAFAGAADVIQDLGLEWLSQDITAKLSARVAQG IGVGILTARLGIKAMEFCRPIAVAPEEKLRLSHIQTELLGTLKTTLFSANKVKEKVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HS_0596 |
Synonyms | HS_0596; UPF0283 membrane protein HS_0596 |
UniProt ID | Q0I337 |
◆ Recombinant Proteins | ||
CXCL13-1322R | Recombinant Rhesus CXCL13 protein | +Inquiry |
RPS27.1-7414Z | Recombinant Zebrafish RPS27.1 | +Inquiry |
CD274-8229H | Recombinant Human CD274, Biotin-His-tagged | +Inquiry |
Map2k1-1350MAF488 | Recombinant Mouse Map2k1 Protein, His/GST-tagged, Alexa Fluor 488 conjugated | +Inquiry |
FOLR1-301148H | Recombinant Human FOLR1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
LTF-28999TH | Native Human LTF | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
OMD-137C | Native Chicken Ovomucoid | +Inquiry |
◆ Cell & Tissue Lysates | ||
Uterus-Corpus-556H | Human Uterus-Corpus Membrane Lysate | +Inquiry |
USP50-1897HCL | Recombinant Human USP50 cell lysate | +Inquiry |
RPP30-2179HCL | Recombinant Human RPP30 293 Cell Lysate | +Inquiry |
MDA-MB-361-170H | MDA-MB-361 Whole Cell Lysate | +Inquiry |
DYNC2LI1-6759HCL | Recombinant Human DYNC2LI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HS_0596 Products
Required fields are marked with *
My Review for All HS_0596 Products
Required fields are marked with *
0
Inquiry Basket