Recombinant Rhesus CXCL13 protein

• Cat.No.: CXCL13-1322R
• Product Overview: Recombinant Rhesus CXCL13 protein was expressed in Escherichia coli.

Specification

• Species: Rhesus macaque
• Source: E.coli
• Tag: Non
• Protein Length: 87
• Description: B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 300mM NaCl.
• Molecular Mass: Approximately 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids.
• AA Sequence: VLEVYYTHLRCRCVQESSVFIPRRFIDRIQISPRGNGCPRKEIIVWKKNKSVVCVDPQAEWIQRIMEMLRKKSSSTPPVPVFKRKIP
• Endotoxin: Less than 0.01 EU/μg of rRhCXCL-13 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CXCL13
• Official Symbol: CXCL13
• Gene ID: 574224
• mRNA Refseq: NM_001032880.1
• Protein Refseq: NP_001028052.1
• UniProt ID: Q8HYN9