Recombinant Full Length Gossypium Hirsutum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 2(Hmg2) Protein, His-Tagged
Cat.No. : | RFL7951GF |
Product Overview : | Recombinant Full Length Gossypium hirsutum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2(HMG2) Protein (O64967) (1-628aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium hirsutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-628) |
Form : | Lyophilized powder |
AA Sequence : | MEASRRSAVKPVIVLKPSKRFPLVEDTPGKASDALPLPLYLTNAVFFTLFFTVVYFLLSR WREKIRASIPLHAVTFPEIVAIFAFVASLIYLLGFFGIDFVQSLIIRPSGDVWSGEDYEE ENEVLLHEEDARTVPCGQALDCSVPSLPHMARNVTAQRLFDEKPVRVATEEDARKVSCGQ AVDCSLHSLPPRPPIVTSQKLFHEKTVIVTTEEDEEIIKSVVAGTLPSYSLESKLGDCKR AAAIRREALQRLTGRSLSGLPLDGFDYESILGQCCEMPVGYVQIPVGIAGPLLLNGREYS VPMATTEGCLVASTNRGCKAIHLSGGATSILLKDGMTRAPVVRFSTAKRAAELKFYLEDP ENFDTLAVVFNRSSRFGRLQSIKCAIAGKNLYLRFTCSTGDAMGMNMVSKGVQNVLDFLQ TDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIIEGDVVRKVLKTSVESLVELN MLKNLTGSAMAGALGGFNAHASNIVTAIYIATGQDPAQNVESSHCITMMEAVNDGKDLHI SVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKDVAGANSRMLATIVTGAVLAGELSL MSALAAGQLVKSHMKYNRSSKDMSNLSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG2 |
Synonyms | HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2 |
UniProt ID | O64967 |
◆ Recombinant Proteins | ||
MRPL24-538Z | Recombinant Zebrafish MRPL24 | +Inquiry |
MPPED2-3739R | Recombinant Rat MPPED2 Protein | +Inquiry |
Nos2-65M | Recombinant Mouse Nos2 Protein | +Inquiry |
C11orf63-478H | Recombinant Human C11orf63 Protein, GST-tagged | +Inquiry |
CTBP2-1864H | Recombinant Human CTBP2 Protein (Met1-Leu252), N-His tagged | +Inquiry |
◆ Native Proteins | ||
Streptolysin-171S | Native Streptolysin O protein | +Inquiry |
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
Actin-889P | Native Porcine Actin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Ovary-831M | Mini pig Ovary Membrane Lysate, Total Protein | +Inquiry |
NAP1L1-3977HCL | Recombinant Human NAP1L1 293 Cell Lysate | +Inquiry |
Brain-8H | Human Brain Tumor Tissue Lysate | +Inquiry |
HNRNPK-5443HCL | Recombinant Human HNRNPK 293 Cell Lysate | +Inquiry |
ZFP36-181HCL | Recombinant Human ZFP36 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG2 Products
Required fields are marked with *
My Review for All HMG2 Products
Required fields are marked with *
0
Inquiry Basket