Recombinant Full Length Gossypium Hirsutum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 1(Hmg1) Protein, His-Tagged
Cat.No. : | RFL11867GF |
Product Overview : | Recombinant Full Length Gossypium hirsutum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1(HMG1) Protein (O64966) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gossypium hirsutum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | METHRRSSTNSIRSHKPARPIALEDDSTKASDALPLPLYLTNAVFFTLFFSAVYFLLCRW REKIRSSTPLHVVTFSEIVAILASVASFIYLLGFFGIDFVQSLVLRPSADVWATEDDEVE SEVLLRNEDARHVPCGQALDRSIRSLQPPEPIVTAEKVFDEMPVTVMTEEDEEIIRSVVC GMTPSYSLESKLDDCKRAAAIRREALQRITGKSLSGLPLDGFDYESILGQCCEMPVGYEQ IPVGIAGPLLLNGREYSVPMATTEGCLVASTNRGCKAIHLSGGATSVLLRDGMTRAPVVR FGTAKRAADLKLYLEDPENFETLACVFNRSSRFARLQSIKCAIAGKNLYLRFSCFTGDAM GMNMVSKGVQNVLDFLQTDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAIINGD VVTKVLKTSVESLVELNMLKNLTGSAMAGALGGFNAHASNIVTAVYIATGQDPAQNVESS HCITMMEAVNGGKDLHVSVTMPSIEVGTVGGGTQLASQSACLNLLGVKGASKESPGANSI LLATIVAGAVLAGELSLMSALAAGQLVKSHMKYNRSSKDVSKVSS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG1 |
Synonyms | HMG1; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 1; HMG-CoA reductase 1 |
UniProt ID | O64966 |
◆ Native Proteins | ||
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
a-Actinin-855C | Native Porcine a-Actinin Protein | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
RNASE3-5318H | Native Human Ribonuclease, RNase A Family, 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPR37-1593HCL | Recombinant Human GPR37 cell lysate | +Inquiry |
GNL3-5846HCL | Recombinant Human GNL3 293 Cell Lysate | +Inquiry |
GNS-5836HCL | Recombinant Human GNS 293 Cell Lysate | +Inquiry |
APBB3-8801HCL | Recombinant Human APBB3 293 Cell Lysate | +Inquiry |
SYVN1-1296HCL | Recombinant Human SYVN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG1 Products
Required fields are marked with *
My Review for All HMG1 Products
Required fields are marked with *
0
Inquiry Basket