Recombinant Full Length Glycine Max Omega-6 Fatty Acid Desaturase, Endoplasmic Reticulum Isozyme 1(Fad2-1) Protein, His-Tagged
Cat.No. : | RFL9153GF |
Product Overview : | Recombinant Full Length Glycine max Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1(FAD2-1) Protein (P48630) (1-387aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Glycine max |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-387) |
Form : | Lyophilized powder |
AA Sequence : | MGLAKETTMGGRGRVAKVEVQGKKPLSRVPNTKPPFTVGQLKKAIPPHCFQRSLLTSFSY VVYDLSFAFIFYIATTYFHLLPQPFSLIAWPIYWVLQGCLLTGVWVIAHECGHHAFSKYQ WVDDVVGLTLHSTLLVPYFSWKISHRRHHSNTGSLDRDEVFVPKPKSKVAWFSKYLNNPL GRAVSLLVTLTIGWPMYLAFNVSGRPYDSFASHYHPYAPIYSNRERLLIYVSDVALFSVT YSLYRVATLKGLVWLLCVYGVPLLIVNGFLVTITYLQHTHFALPHYDSSEWDWLKGALAT MDRDYGILNKVFHHITDTHVAHHLFSTMPHYHAMEATNAIKPILGEYYQFDDTPFYKALW REARECLYVEPDEGTSEKGVYWYRNKY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FAD2-1 |
Synonyms | FAD2-1; Omega-6 fatty acid desaturase, endoplasmic reticulum isozyme 1 |
UniProt ID | P48630 |
◆ Recombinant Proteins | ||
pth-4157E | Recombinant Escherichia coli pth protein, His-tagged | +Inquiry |
Tnfrsf13c-218R | Recombinant Rat Tnfrsf13c protein, His/S-tagged | +Inquiry |
ACTG1-60H | Recombinant Human Actin, Gamma 1, T7-tagged | +Inquiry |
TMEM215-4622R | Recombinant Rhesus Macaque TMEM215 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL11929AF | Recombinant Full Length Arabidopsis Thaliana Ubiquitin Carboxyl-Terminal Hydrolase 27(Ubp27) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
G6PD-26 | Active Native Glucose-6-phosphate dehydrogenase | +Inquiry |
CA2-34R | Native Rabbit Carbonic Anhydrase II (CA2) Protein | +Inquiry |
C4-195H | Native Human Complement C4c | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
ALB-116R | Native Rabbit Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCL2L13-61HCL | Recombinant Human BCL2L13 lysate | +Inquiry |
Bladder-737R | Rabbit Bladder Lysate, Total Protein | +Inquiry |
ATP1A3-8611HCL | Recombinant Human ATP1A3 293 Cell Lysate | +Inquiry |
SLMO1-612HCL | Recombinant Human SLMO1 lysate | +Inquiry |
ACTL6A-9061HCL | Recombinant Human ACTL6A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FAD2-1 Products
Required fields are marked with *
My Review for All FAD2-1 Products
Required fields are marked with *
0
Inquiry Basket