Recombinant Full Length Arabidopsis Thaliana Ubiquitin Carboxyl-Terminal Hydrolase 27(Ubp27) Protein, His-Tagged
Cat.No. : | RFL11929AF |
Product Overview : | Recombinant Full Length Arabidopsis thaliana Ubiquitin carboxyl-terminal hydrolase 27(UBP27) Protein (Q9FPS0) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arabidopsis thaliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFS GREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQ LPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQ EEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMC RTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHG AALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKL LCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIGVNIEERIEMSSEYQKPEASKN HGMYRLVTVVEHFGRTGSGHYTVYRSVRVFSQEEEEEDCDEDLSWFSISDSEVCRVSESD VLGAEASLLFYERL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UBP27 |
Synonyms | UBP27; At4g39370; F23K16.5; Ubiquitin carboxyl-terminal hydrolase 27; Deubiquitinating enzyme 27; AtUBP27; Ubiquitin thioesterase 27; Ubiquitin-specific-processing protease 27 |
UniProt ID | Q9FPS0 |
◆ Recombinant Proteins | ||
PRL-9618Z | Recombinant Zebrafish PRL | +Inquiry |
N-196V | Recombinant COVID-19 (2019 novel coronavirus) Nucleocapsid protein, His-tagged | +Inquiry |
RFL28306EF | Recombinant Full Length Horse Atp Synthase Subunit A(Mt-Atp6) Protein, His-Tagged | +Inquiry |
GRA-5901Z | Recombinant Zebrafish GRA | +Inquiry |
EGR1-52 | Recombinant Human EGR1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HPX-84R | Native Rat Hemopexin | +Inquiry |
EPX-1862H | Native Human Eosinophil Peroxidase | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
NADS-33 | Active Native NAD synthase | +Inquiry |
TF-103H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NIH/3T3-065MCL | Mouse PDGF Stimulated NIH/3T3 Whole Cell Lysate | +Inquiry |
CD79A-7673HCL | Recombinant Human CD79A 293 Cell Lysate | +Inquiry |
CES5A-7563HCL | Recombinant Human CES7 293 Cell Lysate | +Inquiry |
PSMB5-2771HCL | Recombinant Human PSMB5 293 Cell Lysate | +Inquiry |
CYP2U1-435HCL | Recombinant Human CYP2U1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBP27 Products
Required fields are marked with *
My Review for All UBP27 Products
Required fields are marked with *
0
Inquiry Basket