Recombinant Full Length Gallid Herpesvirus 2 Envelope Protein Ul45 Homolog(Ul45H) Protein, His-Tagged
Cat.No. : | RFL1647GF |
Product Overview : | Recombinant Full Length Gallid herpesvirus 2 Envelope protein UL45 homolog(UL45H) Protein (P22653) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gallid herpesvirus 2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MMSPTPEDDRDLVVVRGRLRMMDNGAEHDRERRSYTAWPHLCCGCTIGIILTMFVIATTL LLASLFAFSYMSLESGTCPKEWIGLGYSCMRVAGNNATELEALDMCAQHNSKLVDFTNAK TLVEAIVPFGSTNASFGNIFRLRDSRSTCILPTIGGPISVDCPRTCSVVCQRPRPLSTAA SIIRDARIYLRLERRDYYEVYSSILSNAIMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | UL45H |
Synonyms | UL45H; Envelope protein UL45 homolog |
UniProt ID | P22653 |
◆ Native Proteins | ||
Lectin-1771D | Active Native Dolichos Biflorus Lectin Protein | +Inquiry |
LDHA-8315C | Native Chicken LDHA | +Inquiry |
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
Pancreas-364H | Human Pancreas Membrane Diabetic Disease Lysate | +Inquiry |
FANCB-593HCL | Recombinant Human FANCB cell lysate | +Inquiry |
GPR150-5795HCL | Recombinant Human GPR150 293 Cell Lysate | +Inquiry |
TBL1Y-1213HCL | Recombinant Human TBL1Y 293 Cell Lysate | +Inquiry |
PRR14-2815HCL | Recombinant Human PRR14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UL45H Products
Required fields are marked with *
My Review for All UL45H Products
Required fields are marked with *
0
Inquiry Basket