Recombinant Full Length Anaeromyxobacter Sp. Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL5854AF |
Product Overview : | Recombinant Full Length Anaeromyxobacter sp. Undecaprenyl-diphosphatase(uppP) Protein (A7H6N5) (1-304aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Anaeromyxobacter sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-304) |
Form : | Lyophilized powder |
AA Sequence : | MSLLAAVFLGVLQAATEFLPVSSTAHLLVFGELLGHDLADPRFRAFATIIQTGTTLAVLV YFRTEILSLLAAGLRSLARRRPLETPQSRLAWFIVLGTVPAAVLGKLFEERIEALGNWVI AGSLVVLGLVLLAAERYARHLRTVEDVGARDAVLIGLGQALALVPGSSRSGTTITAGMLL GFTREAAARFSFLLSVPIILGAGGYKLWKTVPVLRGEPSWALATLVGTAVSAVAGYLVID WLLGWLRTRTTHLFVVWRIAAGVALAILIWQGVLPAGHASVSAPAVEAARAADPDAPLGA ALRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Anae109_0163; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A7H6N5 |
◆ Recombinant Proteins | ||
CETN1-27955TH | Recombinant Human CETN1 | +Inquiry |
KRTAP10-6-5796HF | Recombinant Full Length Human KRTAP10-6 Protein, GST-tagged | +Inquiry |
ACTR3-151H | Recombinant Human ACTR3 Protein, His-tagged | +Inquiry |
CD300LG-410H | Recombinant Human CD300LG, LEVLFQ tagged | +Inquiry |
RFL25185GF | Recombinant Full Length Gibberella Zeae Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
C1q-07R | Native Rat C1q Protein | +Inquiry |
SNCB-27206TH | Native Human SNCB | +Inquiry |
Prostate-016H | Human Prostate Lysate, Total Protein | +Inquiry |
CTSD-5325D | Active Native Human CTSD protein | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDP1-1155HCL | Recombinant Human TDP1 293 Cell Lysate | +Inquiry |
PFDN6-3277HCL | Recombinant Human PFDN6 293 Cell Lysate | +Inquiry |
CCDC137-154HCL | Recombinant Human CCDC137 lysate | +Inquiry |
TSPAN2-708HCL | Recombinant Human TSPAN2 lysate | +Inquiry |
ST13-1701HCL | Recombinant Human ST13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket