Recombinant Full Length Staphylococcus Aureus Poly-Beta-1,6-N-Acetyl-D-Glucosamine Synthase(Icaa) Protein, His-Tagged
Cat.No. : | RFL33807SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthase(icaA) Protein (Q9RQP9) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MQFFNFLLFYPVFMSIYWIVGSIYFYFTREIRYSLNKKPDINVDELEGITFLLACYNESE TIEDTLSNVLALKYEKKEIIIINDGSSDNTAELIYKIKENNDFIFVDLQENRGKANALNQ GIKQASYDYVMCLDADTIVDQDAPYYMIENFKHDPKLGAVTGNPRIRNKSSILGKIQTIE YASLIGCIKRSQTLAGAVNTISGVFTLFKKSAVVDVGYWDTDMITEDIAVSWKLHLRGYR IKYEPLAMCWMLVPETLGGLWKQRVRWAQGGHEVLLRDFFSTMKTKRFPLYILMFEQIIS ILWVYIVLLYLGYLFITANFLDYTFMTYSFSIFLLSSFTMTFINVIQFTVALFIDSRYEK KNMAGLIFVSWYPTVYWIINAAVVLVAFPKALKRKKGGYATWSSPDRGNTQR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | icaA |
Synonyms | icaA; SAOUHSC_03002; Poly-beta-1,6-N-acetyl-D-glucosamine synthase; PNAG synthase; Poly-beta-1,6-GlcNAc synthase; Biofilm polysaccharide intercellular adhesin synthesis protein IcaA; Biofilm PIA synthesis protein IcaA; Intercellular adhesion protein A; N- |
UniProt ID | Q9RQP9 |
◆ Recombinant Proteins | ||
NEU1-323H | Recombinant Human NEU1 Protein, His-tagged | +Inquiry |
CISD1-1416R | Recombinant Rat CISD1 Protein | +Inquiry |
PTPRA-467H | Recombinant Human PTPRA, GST-tagged, Active | +Inquiry |
POLR2I-6926M | Recombinant Mouse POLR2I Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTT2-2665H | Recombinant Human GSTT2 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
IgG-351C | Native Cat IgG | +Inquiry |
THBS-260H | Native Human Thrombospondin | +Inquiry |
CG-76H | Active Native Human Chorionic Gonadotropin (CG) | +Inquiry |
Annexin-V-011H | Native Human Annexin-V Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC14L4-579HCL | Recombinant Human SEC14L4 lysate | +Inquiry |
EPB41L1-6587HCL | Recombinant Human EPB41L1 293 Cell Lysate | +Inquiry |
NKIRAS2-3817HCL | Recombinant Human NKIRAS2 293 Cell Lysate | +Inquiry |
TUBB3-648HCL | Recombinant Human TUBB3 293 Cell Lysate | +Inquiry |
DAOA-7079HCL | Recombinant Human DAOA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All icaA Products
Required fields are marked with *
My Review for All icaA Products
Required fields are marked with *
0
Inquiry Basket