Recombinant Full Length Gadus Morhua Melanopsin-A(Opn4A) Protein, His-Tagged
Cat.No. : | RFL36800GF |
Product Overview : | Recombinant Full Length Gadus morhua Melanopsin-A(opn4a) Protein (Q804X9) (1-561aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gadus morhua (Atlantic cod) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-561) |
Form : | Lyophilized powder |
AA Sequence : | MRPSTDTMEADTAATHRNFITKVDVPDHAHYTVAFFVSVIGTLGVTGNALVQFAFYSNKK LRNLPNYFIMNQAASDFLMAFTQSPFFFINCLNREWIFGELGCKLYAFLGALFGITSMIN LLAISLDRYMVITRPLEAMKWNSKRRTTIAILLVWLYSLAWSLAPLVGWSSYIPEGLRTS CTWDYVTYTASNRSYTMMLCCFVFFIPLAIISYCYLFMFLAIRKTSRDVERLGIQVRKST IIRQKSIRTEWKLAKIAFVVIVVYVLSWSPYACVTMISWSGHANILSPYSKTVPAVIAKA STIYNPFIYAIIHQKYRKTLADKVPCLRFLAPNKRKDCTSSSFSGSSYRDSVISRTSTAI RRQSTAASRHASASKTAAGASSYSSSDRVFGDVEMDPIDWRSGASFRRHSSRGSTRRDRL LKKQQMERTNKSAAHKQPSPSTKMSATHCKNKTVSSSVNMAAAPPQLVLIRKRSQSLTNG LSDAGKKTTVANGTPGNHKSKSADLHFRNLPALDQALNVPRIIVISPTSEDCLVKHESSF TDDGSVGTVVDEDSLEDNDVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | opn4a |
Synonyms | opn4a; Melanopsin-A; Opsin-4A |
UniProt ID | Q804X9 |
◆ Native Proteins | ||
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
FGG -48S | Native Sheep Fibrinogen, FITC Labeled | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
Lectin-1861W | Active Native Wheat Germ Agglutinin Protein, Fluorescein labeled | +Inquiry |
CKB-8079H | Active Native Human CKB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TAC3-1287HCL | Recombinant Human TAC3 293 Cell Lysate | +Inquiry |
SMS-1651HCL | Recombinant Human SMS 293 Cell Lysate | +Inquiry |
ACAA2-9118HCL | Recombinant Human ACAA2 293 Cell Lysate | +Inquiry |
GCC1-691HCL | Recombinant Human GCC1 cell lysate | +Inquiry |
GGA1-698HCL | Recombinant Human GGA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All opn4a Products
Required fields are marked with *
My Review for All opn4a Products
Required fields are marked with *
0
Inquiry Basket