Recombinant Full Length Francisella Tularensis Subsp. Holarctica Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL20485FF |
Product Overview : | Recombinant Full Length Francisella tularensis subsp. holarctica Membrane protein insertase YidC(yidC) Protein (Q2A5M8) (1-551aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Francisella tularensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-551) |
Form : | Lyophilized powder |
AA Sequence : | MKANHIRILLLVTIAIMFISLMGKWEQTFPADNTKQQTSATQNNSHYDNADSSTNTDVTI TDAKSSLAKETNFSKYDNAKSITINTVVFKDVKVSLLDGAIISASLKDYSISLDDKTPMS LLTDKSGSEYIAKSTIVVNKQPISVNFEDQGIKIENSKQILTLTGSADGLQITRTYTFDD TKYNISVSQNIKNTTSAPVNVIVDDSFARDFDPAGDSFSLLNAHSYTFTGVAYSTAKDSF RKESFKDISKTNGQPTVINSDGQGWVAFLQHYFVSAWIPQSTNAKIYYKNLNGDVFEAGA FTGATIAPNQSENISSILYTGPIIKANLVDLAPNLEKTLDYGMLSFFSEIIFWVMNHIHS LVGNWGLAIILVTCLIKLIFYPLSAKSYRSMAKMRMLQPRIKRLQETYKDDRQALGKKMM ELYKEEKVNPLSGCLPMLIQIPIFISLYWVLLESVELRQAPFIFWIHDLSMKDPYFVLPV LMGLSMFLQQKLSPAPADPMQAKVMMFLPVIFTFLFASFPSGLVLYWLTNNLISISQQWI ITRHYQATHKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; FTL_0178; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q2A5M8 |
◆ Recombinant Proteins | ||
YJBH-4111B | Recombinant Bacillus subtilis YJBH protein, His-tagged | +Inquiry |
FBXO2-259H | Recombinant Human FBXO2, His-tagged | +Inquiry |
Bcl7a-1851M | Recombinant Mouse Bcl7a Protein, Myc/DDK-tagged | +Inquiry |
TFRC-2124H | Recombinant Human TFRC Protein, His-tagged | +Inquiry |
SULT2B1-301465H | Recombinant Human SULT2B1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
Lectin-1734U | Active Native Ulex Europaeus Agglutinin I Protein, Rhodamine labeled | +Inquiry |
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELP-001CCL | Recombinant Cynomolgus SELP cell lysate | +Inquiry |
ZNF567-2055HCL | Recombinant Human ZNF567 cell lysate | +Inquiry |
HPRT1-5398HCL | Recombinant Human HPRT1 293 Cell Lysate | +Inquiry |
OPA3-3575HCL | Recombinant Human OPA3 293 Cell Lysate | +Inquiry |
ANKRA2-8859HCL | Recombinant Human ANKRA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket