Recombinant Full Length Pelagibacter Ubique Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL27960PF |
Product Overview : | Recombinant Full Length Pelagibacter ubique Membrane protein insertase YidC(yidC) Protein (Q4FNF1) (1-558aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pelagibacter ubique |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-558) |
Form : | Lyophilized powder |
AA Sequence : | MDTRNVIAAISLSAAVIILYSLFFQPDPATIKKNLAEQNKIENNEDTPSLDKNENFSKLS RADALKENDRIQFENGSVVGSISLKGAAIDDLTFKEYNIELNRNEKITLLSPRNVEDGYL IESGFVSTNKNIDIPDASTVWEVSGNNKLTNNNPVKLTWSNTQGITFEKHISLDDQFLFT VKEKIINSSDKSYNFYSYGQIIRNELPEISGFYILHEGFLSVLDDELIEEDYDDIQDKKF TQIAQDGFVAISDKFWVTSVIPPKGKEFKTTFDYKNKFRANYISTKGIEVKANSSIEEKI QIIVAAKRVNVIDGYAENLNINKFDLAIDWGFMYFITKPLFFVLDYFFKLLGNYGLAIIA VTICIRLAFFPLANFSFKSMGKMKLLAPEMARLKELHKDDKMKLQQAMMALYKKEKVNPM SGCLPILVQIPVFFALYKVLFVTIEMRHMPFYGWIHDLSDRDPTSLFNVFGLIPWDPPSF LLIGAWPIIMGITMWIQQKLNPTPPDPIQAKIFMFFPVFLTVILAPFPAGLVIYWSFNNI FTMIQQYIVQRKMTIKTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; SAR11_0466; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | Q4FNF1 |
◆ Recombinant Proteins | ||
Ntrk2-4523M | Recombinant Mouse Ntrk2 Protein, Myc/DDK-tagged | +Inquiry |
Vamp5-6893M | Recombinant Mouse Vamp5 Protein, Myc/DDK-tagged | +Inquiry |
SAP033A-019-2692S | Recombinant Staphylococcus aureus (strain: WBG8404, other: ST45-MRSA-V (5C2)) SAP033A_019 protein, His-tagged | +Inquiry |
RFL2854RF | Recombinant Full Length Rat Taste Receptor Type 2 Member 40(Tas2R40) Protein, His-Tagged | +Inquiry |
MEP1B-246H | Recombinant Human MEP1B Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CFI-105H | Active Native Human Factor I | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
CA-242-380H | Active Native Human Cancer Antigen 242 | +Inquiry |
Trypsin-265H | Native Human Trypsin | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD6-1807MCL | Recombinant Mouse CD6 cell lysate | +Inquiry |
MPZL1-4218HCL | Recombinant Human MPZL1 293 Cell Lysate | +Inquiry |
TSTA3-691HCL | Recombinant Human TSTA3 293 Cell Lysate | +Inquiry |
CXCR6-7160HCL | Recombinant Human CXCR6 293 Cell Lysate | +Inquiry |
NXPH4-1241HCL | Recombinant Human NXPH4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket