Recombinant Full Length Methylobacterium Extorquens Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged
Cat.No. : | RFL28113MF |
Product Overview : | Recombinant Full Length Methylobacterium extorquens Membrane protein insertase YidC(yidC) Protein (A9W590) (1-616aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methylobacterium extorquens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-616) |
Form : | Lyophilized powder |
AA Sequence : | MGNDKTNMFVAIALSLVVLLGWHYFVTGPASERQRQAAQSQTAQTGAPQTADGIPSPSPR EGGPNAPAPGTLPGAAAQGPVSREDALARSARVRIDTPALYGSIGLKGARIDDVSLKNYH ETVSDESPRIVLLSPTGTANPYYAEFGWVGANAGPLPNADTLWKADGDLLAPGRPLTLTW DNGQGLVFKRIVAVDDKFMFTVRDEVENTSANPVTLYPYSLVSRWGKPQTQGYYVLHEGL IGVLGGDGLQEYTYDKVGKEPAYGGAATQGKAWTNVTGGWVGITDKYWAAAAIPEQDKPF TGAFTERTDGATKIYQTSVRGDAVTLAPNASSVTTQRLFAGAKEVNQINAYEREFGIKQF DLMIDWGWFWFLTKPMFRALDFFFHLLGNFGVSILLVTLILKLFFLPIANRSYVSMAKMK AVQPEMTSIRERYKDDRVKQQQAMMELYKKEKINPVAGCWPVLIQIPVFFALYKVLFITI EMRHAPFFGWIQDLAAPDPTSIVNLFGLLPFTPPEYIPIHLGVWPIIMGITMFIQMKMNP APPDPVQAQVFAFMPIVFTFMLGSFPAGLVIYWAWNNTLSVIQQYVIMRRNGVKVELWDN LRGMFKRGNKSAAAKG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | yidC |
Synonyms | yidC; Mext_2351; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC |
UniProt ID | A9W590 |
◆ Recombinant Proteins | ||
MPXV-0720 | Recombinant Monkeypox Virus Protein, IFN-alpha/beta receptor glycoProtein | +Inquiry |
HTR1A-26H | Recombinant Human HTR1A protein, GST-tagged | +Inquiry |
ATP6V1C1-1003H | Recombinant Human ATP6V1C1 protein, GST-tagged | +Inquiry |
STAR-30116TH | Recombinant Human STAR, His-tagged | +Inquiry |
OLFML3-6337M | Recombinant Mouse OLFML3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
IBVT5399-230I | Native nfluenza (B/Tokio/53/99) IBVT5399 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT5B-1709HCL | Recombinant Human STAT5B cell lysate | +Inquiry |
Thymus-500C | Chicken Thymus Lysate, Total Protein | +Inquiry |
L3MBTL4-965HCL | Recombinant Human L3MBTL4 cell lysate | +Inquiry |
CASP2-285HCL | Recombinant Human CASP2 cell lysate | +Inquiry |
SLFN5-611HCL | Recombinant Human SLFN5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All yidC Products
Required fields are marked with *
My Review for All yidC Products
Required fields are marked with *
0
Inquiry Basket