Recombinant Full Length Fatty Acid Desaturase(Desa) Protein, His-Tagged
Cat.No. : | RFL13792AF |
Product Overview : | Recombinant Full Length Fatty acid desaturase(desA) Protein (Q54794) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Arthrospira platensis (Spirulina platensis) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MTLSIVKSEDSSSRPSAVPSDLPLEEDIINTLPSGVFVQDRYKAWMTVIINVVMVGLGWL GIAIAPWFLLPVVWVFTGTALTGFFVIGHDCGHRSFSRNVWVNDWVGHILFLPIIYPFHS WRIGHNQHHKYTNRMELDNAWQPWRKEEYQNAGKFMQVTYDLFRGRAWWIGSILHWASIH FDWTKFEGKQRQQVKFSSLLVIGAAAIAFPTMILTIGVWGFVKFWVIPWLVFHFWMSTFT LLHHTIADIPFREPEQWHEAESQLSGTVHCNYSRWGEFLCHDINVHIPHHVTTAIPWYNL RTPTPVYRKIGGEYLYPECDFSWGLMKQVVDHAICMMRITIISQSLTTKRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | desA |
Synonyms | desA; Delta(12-fatty-acid desaturase |
UniProt ID | Q54794 |
◆ Recombinant Proteins | ||
arcA-17S | Recombinant S.Pyogenes arcA Protein, His-tagged | +Inquiry |
ATMIN-1147HF | Recombinant Full Length Human ATMIN Protein, GST-tagged | +Inquiry |
SLC6A15-5224R | Recombinant Rat SLC6A15 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC39A12-3614H | Recombinant Human SLC39A12 protein, His-tagged | +Inquiry |
RFL4873NF | Recombinant Full Length Nostoc Sp. Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TF-262H | Native Human Transferrin | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
Cry2Ab-37B | Native Bacillus thuringiensis Cry2Ab Protein | +Inquiry |
ung-8332E | Native E.coli ung | +Inquiry |
◆ Cell & Tissue Lysates | ||
Skin-671H | Hamster Skin Lysate, Total Protein | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
TMUB2-786HCL | Recombinant Human TMUB2 cell lysate | +Inquiry |
NHEJ1-3834HCL | Recombinant Human NHEJ1 293 Cell Lysate | +Inquiry |
PAFAH1B3-3467HCL | Recombinant Human PAFAH1B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All desA Products
Required fields are marked with *
My Review for All desA Products
Required fields are marked with *
0
Inquiry Basket