Recombinant Human SLC39A12 protein, His-tagged

• Cat.No.: SLC39A12-3614H
• Product Overview: Recombinant Human SLC39A12 protein(1 - 202 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1 - 202 aa
• AA Sequence: MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC39A12 solute carrier family 39 (zinc transporter), member 12 [ Homo sapiens ]
• Official Symbol: SLC39A12
• Synonyms: SLC39A12; solute carrier family 39 (zinc transporter), member 12; solute carrier family 39 (metal ion transporter), member 12; zinc transporter ZIP12; FLJ30499; zrt- and Irt-like protein 12; solute carrier family 39 member 12; LIV-1 subfamily of ZIP zinc transporter 8; ZIP-12; LZT-Hs8; bA570F3.1; MGC43205; MGC51099
• Gene ID: 221074
• mRNA Refseq: NM_001145195
• Protein Refseq: NP_001138667
• MIM: 608734
• UniProt ID: Q504Y0