Recombinant Full Length Exiguobacterium Sp. Upf0365 Protein Eat1B_0602 (Eat1B_0602) Protein, His-Tagged
Cat.No. : | RFL33494EF |
Product Overview : | Recombinant Full Length Exiguobacterium sp. UPF0365 protein EAT1b_0602 (EAT1b_0602) Protein (C4L412) (1-328aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Exiguobacterium sp. |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-328) |
Form : | Lyophilized powder |
AA Sequence : | MTPELLTTLLITGGGLIALAVFFTFVPVGLWISSFAAGVHVSIFTLIGMRLRRVIPSKIV NPLIKAVKAGIELNTNQLESHFLAGGNVDRVVNALIAAHRANIELSFERAAAIDLAGRNV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIDRLVGGAGEETIIARVGEGV VSTIGSQNNHKHVLENPDMISRTVLTKGLDSGTAFEILSIDIADIDIGKNIGAVLQTDQA EADKKIAQAKAEERRAMAIAREQEMKSSVEEMRAKVVGAEAEVPLAMAEALRNGKLGVMD YVNYLNVQADTEMRKAIGAPVDSESDNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | EAT1b_0602 |
Synonyms | floA; EAT1b_0602; Flotillin-like protein FloA |
UniProt ID | C4L412 |
◆ Native Proteins | ||
S100A1B-9H | Native Human S100A1B | +Inquiry |
GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALPI-1596HCL | Recombinant Human ALPI cell lysate | +Inquiry |
EGFL7-649HCL | Recombinant Human EGFL7 cell lysate | +Inquiry |
ASNA1-137HCL | Recombinant Human ASNA1 cell lysate | +Inquiry |
GALNT6-6035HCL | Recombinant Human GALNT6 293 Cell Lysate | +Inquiry |
HA-2813HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All EAT1b_0602 Products
Required fields are marked with *
My Review for All EAT1b_0602 Products
Required fields are marked with *
0
Inquiry Basket