Recombinant Full Length Esx-3 Secretion System Protein Ecce3(Ecce3) Protein, His-Tagged
Cat.No. : | RFL27213HF |
Product Overview : | Recombinant Full Length ESX-3 secretion system protein EccE3(eccE3) Protein (O53696) (1-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-331) |
Form : | Lyophilized powder |
AA Sequence : | MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFGFWRGLYFTTI ARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLPLTLIARYLDRYGIRADTIRI TSRVTASGDCRTWVGLTVVADDNLAALQARSARIPLQETAQVAARRLADHLREIGWEAGT AAPDEIPALVAADSRETWRGMRHTDSDYVAAYRVSANAELPDTLPAIRSRPAQETWIALE IAYAAGSSTRYTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHT DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ESX-3 secretion system protein EccE3(eccE3) |
UniProt ID | O53696 |
◆ Recombinant Proteins | ||
Mrpl1-7957M | Recombinant Mouse Mrpl1 protein, His & T7-tagged | +Inquiry |
EFS-4238HF | Recombinant Full Length Human EFS Protein, GST-tagged | +Inquiry |
RFL21173HF | Recombinant Full Length Human Herpesvirus 2 Envelope Protein Ul45 (Ul45) Protein, His-Tagged | +Inquiry |
CD302-151H | Recombinant Human CD302 Protein, His-tagged | +Inquiry |
RNASE11-7629M | Recombinant Mouse RNASE11 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
FGA-39B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
IGHA2 -19H | Native Human IgA2 | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BST1-1401RCL | Recombinant Rat BST1 cell lysate | +Inquiry |
C16orf79-8245HCL | Recombinant Human C16orf79 293 Cell Lysate | +Inquiry |
CDK1-670HCL | Recombinant Human CDK1 cell lysate | +Inquiry |
CYP26A1-7121HCL | Recombinant Human CYP26A1 293 Cell Lysate | +Inquiry |
ZNF652-33HCL | Recombinant Human ZNF652 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ESX-3 secretion system protein EccE3(eccE3) Products
Required fields are marked with *
My Review for All ESX-3 secretion system protein EccE3(eccE3) Products
Required fields are marked with *
0
Inquiry Basket