Recombinant Full Length Escherichia Coli Zinc Transport Protein Zntb(Zntb) Protein, His-Tagged
Cat.No. : | RFL6217EF |
Product Overview : | Recombinant Full Length Escherichia coli Zinc transport protein ZntB(zntB) Protein (B6IA59) (1-327aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-327) |
Form : | Lyophilized powder |
AA Sequence : | MEAIKGSDVNVPDAVFAWMLDGRGGVKPLENTDVIDEAHPCWLHLNYVHHDSAQWLATTP LLPNNVRDALAGESTRPRVSRLGEGTLITLRCINGSTDERPDQLVAMRVYMDGRLIVSTR QRKVLALDDVVSDLEEGTGPTDCGGWLVDVCDALTDHSSEFIEQLHDKIIDLEDNLLDQQ IPPRGFLALLRKQLIVMRRYMAPQRDVYARLASERLPWMSDDQRRRMQDIADRLGRGLDE IDACIARTGVMADEIAQVMQENLARRTYTMSLMAMVFLPSTFLTGLFGVNLGGIPGGGWQ FGFSIFCILLVVLIGGVALWLHRSKWL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | zntB |
Synonyms | zntB; ECSE_1396; Zinc transport protein ZntB |
UniProt ID | B6IA59 |
◆ Native Proteins | ||
Fetuin-5263B | Native Bovine Fetuin Protein | +Inquiry |
KNG1-29146TH | Native Human KNG1 | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
SOD1-101B | Active Native Bovine SOD | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PJA2-3159HCL | Recombinant Human PJA2 293 Cell Lysate | +Inquiry |
FERD3L-6263HCL | Recombinant Human FERD3L 293 Cell Lysate | +Inquiry |
NDUFB5-3904HCL | Recombinant Human NDUFB5 293 Cell Lysate | +Inquiry |
SET-1928HCL | Recombinant Human SET 293 Cell Lysate | +Inquiry |
TIMM44-1781HCL | Recombinant Human TIMM44 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All zntB Products
Required fields are marked with *
My Review for All zntB Products
Required fields are marked with *
0
Inquiry Basket